Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gap junction beta-3 protein (GJB3) Human ELISA Kit
D6226 96 Tests

Gap junction beta-3 protein (GJB3) Human ELISA Kit

Sign In for Pricing
View Details
UGP2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
49105124 3x 1.0µg DNA

UGP2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
TMEM212-AS1 ORF Vector (Human) (pORF)
ORF034035 1.0 µg DNA

TMEM212-AS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant GATA3 Monoclonal Antibody
AN301792L-01 50 µL

Recombinant GATA3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GATA3 Monoclonal Antibody
AN301792L-02 100 µL

Recombinant GATA3 Monoclonal Antibody

Sign In for Pricing
View Details
H2-Q8 sgRNA CRISPR Lentivector set (Mouse)
K3021601 3x 1.0 µg

H2-Q8 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details