Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPT3 (SUPT3H) Mouse Monoclonal Antibody [Clone ID: OTI4A6]
TA808170 100 µL

SPT3 (SUPT3H) Mouse Monoclonal Antibody [Clone ID: OTI4A6]

Sign In for Pricing
View Details
Strn4 3'UTR GFP Stable Cell Line
TU271348 1.0 mL

Strn4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TNFRSF6B, GST-Tag, Recombinant (M68, TR6, DCR3, M68E, DJ583P15.1.1, Tumor Necrosis Factor Receptor Superfamily Member 6B) discontinued
501083 200 µg

TNFRSF6B, GST-Tag, Recombinant (M68, TR6, DCR3, M68E, DJ583P15.1.1, Tumor Necrosis Factor Receptor Superfamily Member 6B) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TFF2
MBS8528132-01 0.1 mL

Mouse Monoclonal Antibody to TFF2

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TFF2
MBS8528132-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to TFF2

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to TFF2
MBS8528132-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to TFF2

Sign In for Pricing
View Details