Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIF1AN (Hypoxia Inducible Factor 1 alpha Inhibitor, DKFZp762F1811, Factor Inhibiting HIF1, FIH1, FLJ20615, FLJ22027, Hypoxia Inducible Factor Asparagine Hydroxylase, Prolyl Hydroxylase)
H3848-85 100 µL

HIF1AN (Hypoxia Inducible Factor 1 alpha Inhibitor, DKFZp762F1811, Factor Inhibiting HIF1, FIH1, FLJ20615, FLJ22027, Hypoxia Inducible Factor Asparagine Hydroxylase, Prolyl Hydroxylase)

Sign In for Pricing
View Details
EST1A (SMG6) (NM_001256827) Human Untagged Clone
SC330527 10 µg

EST1A (SMG6) (NM_001256827) Human Untagged Clone

Sign In for Pricing
View Details
Stt3b 3'UTR Lenti-reporter-Luc Vector
45785086 1.0 µg

Stt3b 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Ubxn7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6149107 1.0 µg DNA

Ubxn7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
SYCE3 Antibody
MBS8593548-01 0.1 mg

SYCE3 Antibody

Sign In for Pricing
View Details
SYCE3 Antibody
MBS8593548-02 0.1 mL (AF405L)

SYCE3 Antibody

Sign In for Pricing
View Details