Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF12-TNFSF13 (NM_172089) Human 3' UTR Clone
SC209941 10 µg

TNFSF12-TNFSF13 (NM_172089) Human 3' UTR Clone

Sign In for Pricing
View Details
Neurotensin Receptor 2 (NTSR2) (NM_012344) Human Tagged Lenti ORF Clone
RC205343L1 10 µg

Neurotensin Receptor 2 (NTSR2) (NM_012344) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse DZIP1 Protein, His (Fc)-Avi-tagged
DZIP1-2594M 50 µg

Recombinant Mouse DZIP1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Atomoxetine, Hydrochloride (R-Tomexetine, Hydrochloride, (R) -N-Methyl- (2-methylphenoxy) benzenepropanamine, Hydrochloride)
A3975 10 mg

Atomoxetine, Hydrochloride (R-Tomexetine, Hydrochloride, (R) -N-Methyl- (2-methylphenoxy) benzenepropanamine, Hydrochloride)

Sign In for Pricing
View Details
Chondroitin Sulfate Proteoglycan (NG2, CSPG) (AP) discontinued
C5067-70K-AP 100 µL

Chondroitin Sulfate Proteoglycan (NG2, CSPG) (AP) discontinued

Sign In for Pricing
View Details
IL9RP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1077908 1.0 µg DNA

IL9RP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details