Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Afadin (MLLT4) ELISA Kit
MBS7221282-01 48 Well

Mouse Afadin (MLLT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Afadin (MLLT4) ELISA Kit
MBS7221282-02 96 Well

Mouse Afadin (MLLT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Afadin (MLLT4) ELISA Kit
MBS7221282-03 5x 96 Well

Mouse Afadin (MLLT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Afadin (MLLT4) ELISA Kit
MBS7221282-04 10x 96 Well

Mouse Afadin (MLLT4) ELISA Kit

Sign In for Pricing
View Details
Mouse Hippocampal Neuron Cell Line-HT22-GFP-Puro
CC9F82 1x 10^6 Cells/Vial

Mouse Hippocampal Neuron Cell Line-HT22-GFP-Puro

Sign In for Pricing
View Details
4-Nitrophenyl 2,3-Di-O- (2,3,4,6-tetra-O-acetyl-b-D-glucopyranosyl) -b-D-glucopyranoside
N2594-06P 1 mg

4-Nitrophenyl 2,3-Di-O- (2,3,4,6-tetra-O-acetyl-b-D-glucopyranosyl) -b-D-glucopyranoside

Sign In for Pricing
View Details