Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Polypeptide GalNac Transferase 7/GALNT7 Antibody
NBP3-09941-100ul 100 µL

Rabbit Polyclonal Polypeptide GalNac Transferase 7/GALNT7 Antibody

Sign In for Pricing
View Details
Human Exosome Component 2 ELISA Kit (EXOSC2)
RK01330 96 Tests

Human Exosome Component 2 ELISA Kit (EXOSC2)

Sign In for Pricing
View Details
Crtc2 (C-term) Goat Polyclonal Antibody
AP23665PU-N 100 µg

Crtc2 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Mouse CACHD1 siRNA
abx910058-01 15 nmol

Mouse CACHD1 siRNA

Sign In for Pricing
View Details
Mouse CACHD1 siRNA
abx910058-02 30 nmol

Mouse CACHD1 siRNA

Sign In for Pricing
View Details
3- (4-Bromophenyl) -5-tert-butyl-1,2,4-oxadiazole
sc-298791A 5 g

3- (4-Bromophenyl) -5-tert-butyl-1,2,4-oxadiazole

Sign In for Pricing
View Details