Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Probable Diguanylate Cyclase YedQ (DGC) ELISA Kit
MBS9397304 Inquire

Goose Probable Diguanylate Cyclase YedQ (DGC) ELISA Kit

Sign In for Pricing
View Details
Hsd11b1 3'UTR GFP Stable Cell Line
TU255973 1.0 mL

Hsd11b1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal TSPAN32/TSSC6 Antibody
NBP1-62646 100 µL

Rabbit Polyclonal TSPAN32/TSSC6 Antibody

Sign In for Pricing
View Details
Porcine CD274 Molecule (CD274) ELISA Kit-Sandwich
EK9F710-01 48 Test

Porcine CD274 Molecule (CD274) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine CD274 Molecule (CD274) ELISA Kit-Sandwich
EK9F710-02 96 Tests

Porcine CD274 Molecule (CD274) ELISA Kit-Sandwich

Sign In for Pricing
View Details
TRPV1 Protein Vector (Rat) (pPM-C-HA)
48530026 500 ng

TRPV1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details