Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Pannexin-1 Protein - (Dry Ice)
H00024145-P01-10ug 10 µg

Recombinant Human Pannexin-1 Protein - (Dry Ice)

Sign In for Pricing
View Details
CMTA2 Polyclonal Antibody
ABP58199-01 30 µL

CMTA2 Polyclonal Antibody

Sign In for Pricing
View Details
CMTA2 Polyclonal Antibody
ABP58199-02 100 µL

CMTA2 Polyclonal Antibody

Sign In for Pricing
View Details
CMTA2 Polyclonal Antibody
ABP58199-03 200 µL

CMTA2 Polyclonal Antibody

Sign In for Pricing
View Details
S100A9 (S100 Calcium Binding Protein A9) BioAssayTM ELISA Kit (Human) discontinued
384309 96 Tests

S100A9 (S100 Calcium Binding Protein A9) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Human Factor-related Apoptosis,FAS ELISA Kit
CN-03164H1 96T

Human Factor-related Apoptosis,FAS ELISA Kit

Sign In for Pricing
View Details