Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR1-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

Product Specifications

Product Name Alternative

CNR1 Protein-VLP, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr1-protein-vlp-human-hek293-his.html

Smiles

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Molecular Formula

1268 (Gene_ID) P21554 (M1-L472) (Accession)

Molecular Weight

54.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP6 (NM_001130958) Human 3' UTR Clone
SC200247 10 µg

FABP6 (NM_001130958) Human 3' UTR Clone

Sign In for Pricing
View Details
Mouse Cluster Of Differentiation 30 (CD30) ELISA Kit
MBS9716731-01 48 Tests

Mouse Cluster Of Differentiation 30 (CD30) ELISA Kit

Sign In for Pricing
View Details
Mouse Cluster Of Differentiation 30 (CD30) ELISA Kit
MBS9716731-02 96 Tests

Mouse Cluster Of Differentiation 30 (CD30) ELISA Kit

Sign In for Pricing
View Details
Mouse Cluster Of Differentiation 30 (CD30) ELISA Kit
MBS9716731-03 5x 96 Tests

Mouse Cluster Of Differentiation 30 (CD30) ELISA Kit

Sign In for Pricing
View Details
Human uPAR ELISA Kit
E029619-01 1 Each

Human uPAR ELISA Kit

Sign In for Pricing
View Details
Human uPAR ELISA Kit
E029619-02 1 Each

Human uPAR ELISA Kit

Sign In for Pricing
View Details