Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRH1, Human (His)

HRH1 Protein, Human (His) is the recombinant human-derived HRH1, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HRH1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/hrh1-protein-human-his.html

Purity

95.00

Smiles

AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ

Molecular Formula

3269 (Gene_ID) P35367 (A211-Q416) (Accession)

Molecular Weight

Observed band size: 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vericiguat-D3
TRC-V415241-100MG 100 mg

Vericiguat-D3

Sign In for Pricing
View Details
ALIX (PDCD6IP) Human Gene Knockout Kit (CRISPR)
KN203735RB 1 Kit

ALIX (PDCD6IP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ID2 (NM_002166) Human Over-expression Lysate
LC400786 20 µg

ID2 (NM_002166) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human cIAP1/HIAP2 Protein (AVI Tag)
PKSH031263 100 µg

Recombinant Human cIAP1/HIAP2 Protein (AVI Tag)

Sign In for Pricing
View Details
Apigenin 7-Glucuronide
TRC-A726505-5MG 5 mg

Apigenin 7-Glucuronide

Sign In for Pricing
View Details
General Purpose Incubator BIGP-610
BIGP-610 1 Unit

General Purpose Incubator BIGP-610

Sign In for Pricing
View Details