Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRH1, Human (His)

HRH1 Protein, Human (His) is the recombinant human-derived HRH1, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HRH1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/hrh1-protein-human-his.html

Purity

95.00

Smiles

AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ

Molecular Formula

3269 (Gene_ID) P35367 (A211-Q416) (Accession)

Molecular Weight

Observed band size: 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Metastasis, unknown source
CS501432 5x 5 µm

Frozen Tissue Sections, Metastasis, unknown source

Sign In for Pricing
View Details
Human 26S-PSM (26S Proteasome) CLIA Kit
E-CL-H0193-01 24 Tests

Human 26S-PSM (26S Proteasome) CLIA Kit

Sign In for Pricing
View Details
Human 26S-PSM (26S Proteasome) CLIA Kit
E-CL-H0193-02 48 Tests

Human 26S-PSM (26S Proteasome) CLIA Kit

Sign In for Pricing
View Details
Human 26S-PSM (26S Proteasome) CLIA Kit
E-CL-H0193-03 96 Tests

Human 26S-PSM (26S Proteasome) CLIA Kit

Sign In for Pricing
View Details
Ankef1 Mouse Gene Knockout Kit (CRISPR)
KN501251 1 Kit

Ankef1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dystrophia myotonica protein kinase (DMPK) Human Gene Knockout Kit (CRISPR)
KN209151BN 1 Kit

Dystrophia myotonica protein kinase (DMPK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details