Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRH1, Human (His)

HRH1 Protein, Human (His) is the recombinant human-derived HRH1, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HRH1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/hrh1-protein-human-his.html

Purity

95.00

Smiles

AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ

Molecular Formula

3269 (Gene_ID) P35367 (A211-Q416) (Accession)

Molecular Weight

Observed band size: 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP39 Rabbit Monoclonal Antibody [Clone ID: 24GB1810]
TA425314 100 µL

USP39 Rabbit Monoclonal Antibody [Clone ID: 24GB1810]

Sign In for Pricing
View Details
Human Semaphorin 3D (SEMA3D) activation kit by CRISPRa
GA116692 1 Kit

Human Semaphorin 3D (SEMA3D) activation kit by CRISPRa

Sign In for Pricing
View Details
Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Orange Fluorescence Excited at 405 nm*
22830-AAT 100 Tests

Cell Meter™ Annexin V Binding Apoptosis Assay Kit *Orange Fluorescence Excited at 405 nm*

Sign In for Pricing
View Details
CTLA4 / CD152 (Negative Regulator of T-Cells) (L4P2F5.F10), 0.2mg/mL
BNUB1696-100 1x 100 µL

CTLA4 / CD152 (Negative Regulator of T-Cells) (L4P2F5.F10), 0.2mg/mL

Sign In for Pricing
View Details
Iminostilbene
TRC-I445000-5G 5 g

Iminostilbene

Sign In for Pricing
View Details
rac Salsolinol, Hydrobromide
TRC-S099995-1G 1 g

rac Salsolinol, Hydrobromide

Sign In for Pricing
View Details