Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYH, Human

PHYH protein catalyzes 2-hydroxylation of various mono-branched and straight-chain acyl-CoA esters, including racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA. It acts on acyl-CoAs with a chain length of at least seven carbon atoms, excluding long, very long straight-chain, and 2-methyl or 4-methyl-branched acyl-CoAs. PHYH Protein, Human is the recombinant human-derived PHYH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PHYH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/phyh-protein-human.html

Purity

98.0

Smiles

SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Molecular Formula

5264 (Gene_ID) O14832-1 (S31-L338) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin-12 shRNA Plasmid (h)
sc-72915-SH 20 µg

Claudin-12 shRNA Plasmid (h)

Sign In for Pricing
View Details
Leukemia Inhibitory Factor (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI) (MaxLight 490) discontinued
L2024-01D-ML490 100 µL

Leukemia Inhibitory Factor (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Free T4 AccuLite CLIA Kit
1275-300A 96 Well

Free T4 AccuLite CLIA Kit

Sign In for Pricing
View Details
[KO Validated] Calpain 1 Rabbit pAb
A18006 200 µL

[KO Validated] Calpain 1 Rabbit pAb

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]
AN00317J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]
AN00317J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD172a/b Antibody[SE5A5]

Sign In for Pricing
View Details