Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYH, Human

PHYH protein catalyzes 2-hydroxylation of various mono-branched and straight-chain acyl-CoA esters, including racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA. It acts on acyl-CoAs with a chain length of at least seven carbon atoms, excluding long, very long straight-chain, and 2-methyl or 4-methyl-branched acyl-CoAs. PHYH Protein, Human is the recombinant human-derived PHYH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PHYH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/phyh-protein-human.html

Purity

98.0

Smiles

SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Molecular Formula

5264 (Gene_ID) O14832-1 (S31-L338) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human OPN1LW sgRNA gene knockout kit - Lentiviral human OPN1LW sgRNA gene knockout kit (plasmid)
GTR15395450 1 Vial

Lentiviral human OPN1LW sgRNA gene knockout kit - Lentiviral human OPN1LW sgRNA gene knockout kit (plasmid)

Ask
View Details
Recombinant Mouse CD279/PDCD1/PD1 Protein, C-His
MBS1576355-01 0.1 mg

Recombinant Mouse CD279/PDCD1/PD1 Protein, C-His

Ask
View Details
Recombinant Mouse CD279/PDCD1/PD1 Protein, C-His
MBS1576355-02 1 mg

Recombinant Mouse CD279/PDCD1/PD1 Protein, C-His

Ask
View Details
Recombinant Mouse CD279/PDCD1/PD1 Protein, C-His
MBS1576355-03 5x 1 mg

Recombinant Mouse CD279/PDCD1/PD1 Protein, C-His

Ask
View Details
LRRC26, CT (LRRC26, CAPC, Leucine-rich repeat-containing protein 26, BK channel auxilliary gamma subunit LRRC26, Cytokeratin-associated protein in cancer)
037946 200 µL

LRRC26, CT (LRRC26, CAPC, Leucine-rich repeat-containing protein 26, BK channel auxilliary gamma subunit LRRC26, Cytokeratin-associated protein in cancer)

Ask
View Details
PAK1IP1 Antibody
MBS8502021-01 0.1 mg

PAK1IP1 Antibody

Ask
View Details