Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYH, Human

PHYH protein catalyzes 2-hydroxylation of various mono-branched and straight-chain acyl-CoA esters, including racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA. It acts on acyl-CoAs with a chain length of at least seven carbon atoms, excluding long, very long straight-chain, and 2-methyl or 4-methyl-branched acyl-CoAs. PHYH Protein, Human is the recombinant human-derived PHYH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PHYH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/phyh-protein-human.html

Purity

98.0

Smiles

SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Molecular Formula

5264 (Gene_ID) O14832-1 (S31-L338) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT20 Protein Vector (Human) (pPM-C-HA)
24289022 500 ng

IFT20 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-NXT2 Rabbit pAb
GB112636 100 μL

Anti-NXT2 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral human CST9L shRNA (UAS) - Lentiviral human CST9L shRNA (UAS, RFP) (25)
GTR15099407 1 Vial

Lentiviral human CST9L shRNA (UAS) - Lentiviral human CST9L shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Isoconazole nitrate
B1956-5.1 10 mM (in 1mL DMSO)

Isoconazole nitrate

Sign In for Pricing
View Details
CHIP Mouse Monoclonal Antibody
orb1473629-01 30 µL

CHIP Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CHIP Mouse Monoclonal Antibody
orb1473629-02 50 μL

CHIP Mouse Monoclonal Antibody

Sign In for Pricing
View Details