Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYH, Human

PHYH protein catalyzes 2-hydroxylation of various mono-branched and straight-chain acyl-CoA esters, including racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA. It acts on acyl-CoAs with a chain length of at least seven carbon atoms, excluding long, very long straight-chain, and 2-methyl or 4-methyl-branched acyl-CoAs. PHYH Protein, Human is the recombinant human-derived PHYH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PHYH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/phyh-protein-human.html

Purity

98.0

Smiles

SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Molecular Formula

5264 (Gene_ID) O14832-1 (S31-L338) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inactivated Borrelia Burgdorferi Antigen
VAng-Lsx1726-1mg 1 mg

Inactivated Borrelia Burgdorferi Antigen

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human Lambda Light Chain mAb
A24304-01 100 Tests

ABflo® 647 Rabbit anti-Human Lambda Light Chain mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human Lambda Light Chain mAb
A24304-02 50 Tests

ABflo® 647 Rabbit anti-Human Lambda Light Chain mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human Lambda Light Chain mAb
A24304-03 200 Tests

ABflo® 647 Rabbit anti-Human Lambda Light Chain mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human Lambda Light Chain mAb
A24304-04 500 Tests

ABflo® 647 Rabbit anti-Human Lambda Light Chain mAb

Sign In for Pricing
View Details
SPOP (NM_003563) Human Over-expression Lysate
LH19191V 100 µg

SPOP (NM_003563) Human Over-expression Lysate

Sign In for Pricing
View Details