Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHYH, Human

PHYH protein catalyzes 2-hydroxylation of various mono-branched and straight-chain acyl-CoA esters, including racemic phytanoyl-CoA and isomers of 3-methylhexadecanoyl-CoA. It acts on acyl-CoAs with a chain length of at least seven carbon atoms, excluding long, very long straight-chain, and 2-methyl or 4-methyl-branched acyl-CoAs. PHYH Protein, Human is the recombinant human-derived PHYH protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PHYH Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/phyh-protein-human.html

Purity

98.0

Smiles

SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Molecular Formula

5264 (Gene_ID) O14832-1 (S31-L338) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fish G-Protein Coupled Receptor 15 (GPR15) ELISA Kit
MBS9909377 Inquire

Fish G-Protein Coupled Receptor 15 (GPR15) ELISA Kit

Ask
View Details
NAT2 (Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, N-acetyltransferase Type 2, NAT-2, Polymorphic Arylamine N-acetyltransferase, PNAT, AAC2) (AP) discontinued
138172-AP 100 µL

NAT2 (Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, N-acetyltransferase Type 2, NAT-2, Polymorphic Arylamine N-acetyltransferase, PNAT, AAC2) (AP) discontinued

Ask
View Details
Recombinant Human ALOX5AP / FLAP Protein (His tag)
E53A06427 50 µg

Recombinant Human ALOX5AP / FLAP Protein (His tag)

Ask
View Details
Lentiviral mouse Nrap shRNA (UAS) - Lentiviral mouse Nrap shRNA (UAS, iRFP) (25)
GTR15228014 1 Vial

Lentiviral mouse Nrap shRNA (UAS) - Lentiviral mouse Nrap shRNA (UAS, iRFP) (25)

Ask
View Details
MARCH5, NT (MARCH5, RNF153, E3 ubiquitin-protein ligase MARCH5, Membrane-associated RING finger protein 5, Membrane-associated RING-CH protein V, Mitochondrial ubiquitin ligase, RING finger protein 153) (PE) discontinued
038196-PE 200 µL

MARCH5, NT (MARCH5, RNF153, E3 ubiquitin-protein ligase MARCH5, Membrane-associated RING finger protein 5, Membrane-associated RING-CH protein V, Mitochondrial ubiquitin ligase, RING finger protein 153) (PE) discontinued

Ask
View Details
Recombinant Tityus serrulatus Venom allergen 5
MBS1068122-01 0.02 mg (E-Coli)

Recombinant Tityus serrulatus Venom allergen 5

Ask
View Details