Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNA-binding HU-alpha, E.coli (His-SUMO)

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, wraps DNA, offering stabilization and preventing denaturation in challenging conditions. Comprising alpha and beta chains in a heterodimer, it demonstrates versatile DNA binding and protective functions. DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) is the recombinant E. coli-derived DNA-binding protein HU-alpha protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

DNA-binding protein HU-alpha Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dna-binding-protein-hu-alpha-protein-e-coli-his-sumo.html

Purity

90.0

Smiles

MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

Molecular Formula

914933 (Gene_ID) P0ACF2 (M1-K90) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rap2a Mouse Gene Knockout Kit (CRISPR)
KN514469 1 Kit

Rap2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF647 conjugate, 0.1mg/mL
BNC470486-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1472), CF647 conjugate, 0.1mg/mL
BNC471472-100 1x 100 µL

BRCA1 (Breast Marker) (BRCA1/1472), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS645979 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit
RD-MYL1-Hu-01 96 Tests

Human Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit
RD-MYL1-Hu-02 48 Tests

Human Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit

Sign In for Pricing
View Details