Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active)

Product Specifications

Product Name Alternative

TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor Gene names

Abbreviation

Recombinant Mouse Tnfsf15 protein, partial (Active)

Gene Name

Tnfsf15

UniProt

Q5UBV8

Expression Region

61-252aa

Organism

Mus musculus (Mouse)

Target Sequence

AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

Tag

N-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro) . Promotes activation of caspases and apoptosis.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Tnfsf15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody (CSB-RA023992MA1HU) . The EC50 is 1.671-2.506 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.3 kDa

References & Citations

TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator. Migone T.-S., Zhang J., Luo X., Zhuang L., Chen C., Hu B., Hong J.S., Perry J.W., Chen S.-F., Wei P. Immunity 16:479-492 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (phospho Thr3) Polyclonal Antibody
RA25873-01 50 µL

Histone H3 (phospho Thr3) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 (phospho Thr3) Polyclonal Antibody
RA25873-02 100 µL

Histone H3 (phospho Thr3) Polyclonal Antibody

Sign In for Pricing
View Details
Rat Collagen Type Ⅱ (Col Ⅱ) ELISA Kit
GA-E0035RT-01 48 Tests

Rat Collagen Type Ⅱ (Col Ⅱ) ELISA Kit

Sign In for Pricing
View Details
Rat Collagen Type Ⅱ (Col Ⅱ) ELISA Kit
GA-E0035RT-02 96 Tests

Rat Collagen Type Ⅱ (Col Ⅱ) ELISA Kit

Sign In for Pricing
View Details
Human CYB5 ELISA Kit
E102339 1 Each

Human CYB5 ELISA Kit

Sign In for Pricing
View Details
Alpha Smooth Muscle Actin Rabbit Monoclonal Antibody
E38QA8067 100 µL

Alpha Smooth Muscle Actin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details