Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Creatine kinase (CKM), partial

Product Specifications

Abbreviation

Recombinant Horse CKM protein, partial

Gene Name

CKM

UniProt

F7BR99

Expression Region

136-381aa

Organism

Equus caballus (Horse)

Target Sequence

SIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILKRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.9 kDa

References & Citations

"Genome sequence, comparative analysis, and population genetics of the domestic horse." Broad Institute Genome Sequencing Platform, Broad Institute Whole Genome Assembly Team Wade C.M., Giulotto E., Sigurdsson S., Zoli M., Gnerre S., Imsland F., Lear T.L., Adelson D.L., Bailey E., Bellone R.R., Bloecker H., Distl O., Edgar R.C., Garber M., Leeb T., Mauceli E., MacLeod J.N., Penedo M.C.T. Lindblad-Toh K. Science 326:865-867 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Rho GDP-dissociation inhibitor 1 Protein, GST, E.coli-50ug
QP8308-ec-50ug 50ug

Recombinant Human Rho GDP-dissociation inhibitor 1 Protein, GST, E.coli-50ug

Sign In for Pricing
View Details
MAP3K15, NT (MAP3K15, ASK3, Mitogen-activated protein kinase kinase kinase 15, Apoptosis signal-regulating kinase 3, MAPK/ERK kinase kinase 15) (FITC) discontinued
038144-FITC 200 µL

MAP3K15, NT (MAP3K15, ASK3, Mitogen-activated protein kinase kinase kinase 15, Apoptosis signal-regulating kinase 3, MAPK/ERK kinase kinase 15) (FITC) discontinued

Sign In for Pricing
View Details
MGAT5 3'UTR GFP Stable Cell Line
TU063320 1.0 mL

MGAT5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Goat A disintegrin and metalloproteinase with thrombospondin motifs 16 (ADAMTS16) ELISA Kit
MBS7249610-01 48 Well

Goat A disintegrin and metalloproteinase with thrombospondin motifs 16 (ADAMTS16) ELISA Kit

Sign In for Pricing
View Details
Goat A disintegrin and metalloproteinase with thrombospondin motifs 16 (ADAMTS16) ELISA Kit
MBS7249610-02 96 Well

Goat A disintegrin and metalloproteinase with thrombospondin motifs 16 (ADAMTS16) ELISA Kit

Sign In for Pricing
View Details
Goat A disintegrin and metalloproteinase with thrombospondin motifs 16 (ADAMTS16) ELISA Kit
MBS7249610-03 5x 96 Well

Goat A disintegrin and metalloproteinase with thrombospondin motifs 16 (ADAMTS16) ELISA Kit

Sign In for Pricing
View Details