Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB5, Human (Trx)

ABCB5, N-Trx Protein, Human is a plasma membrane-spanning protein that in humans is encoded by the ABCB5 gene. ABCB5 is an ABC transporter and P-glycoprotein family member principally expressed in physiological skin and human malignant melanoma[1].

Product Specifications

Product Name Alternative

ABCB5 Protein, Human (Trx), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/abcb5-n-trx-protein-human.html

Smiles

IRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFV

Molecular Formula

340273 (Gene_ID) Q2M3G0-4 (I586-V692) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

ABCB5αABCB5β

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPH6A Rabbit Polyclonal Antibody (APC)
orb1002025 100 µL

RSPH6A Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mouse Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform (PIK3CG) ELISA kit
GTR10410088 96 Well

Mouse Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform (PIK3CG) ELISA kit

Sign In for Pricing
View Details
ODAM (NM_017855) Human Over-expression Lysate
LH10485V 100 µg

ODAM (NM_017855) Human Over-expression Lysate

Sign In for Pricing
View Details
SATB2 Antibody
24694 100 µL

SATB2 Antibody

Sign In for Pricing
View Details
3,5-Bis (hydroxymethyl) benzoic acid
YEA06560-01 50 mg

3,5-Bis (hydroxymethyl) benzoic acid

Sign In for Pricing
View Details
3,5-Bis (hydroxymethyl) benzoic acid
YEA06560-02 0.5 g

3,5-Bis (hydroxymethyl) benzoic acid

Sign In for Pricing
View Details