Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-3/CD33, Human (HEK293, hFc)

Siglec-3/CD33 protein is a sialic acid-binding lectin that mediates cell-cell interactions and maintains immune cell quiescence. It prefers α-2,3- and α-2,6-linked glycans with sialic acid. Siglec-3/CD33 Protein, Human (HEK293, hFc) is the recombinant human-derived Siglec-3/CD33 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-3/CD33 Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-3-cd33-protein-human-hek293-fc.html

Purity

95.00

Smiles

DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

Molecular Formula

945 (Gene_ID) P20138-1/AAH28152.1 (D18-H259) (Accession)

Molecular Weight

68-80 kDa (glycosylation)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1A1 antibody
10R-3263 100 µL

AKR1A1 antibody

Sign In for Pricing
View Details
Dact1 ORF Vector (Mouse) (pORF)
17638014 1.0 µg DNA

Dact1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
IRX6 Blocking Peptide
33R-8436 100 ug

IRX6 Blocking Peptide

Sign In for Pricing
View Details
Human PRPF3 Pre-designed siRNA Set B
SI012886B 1 Each

Human PRPF3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
DCAF17 Protein Vector (Rat) (pPM-C-HA)
17704026 500 ng

DCAF17 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
HOXB9 polyclonal antibody
orb1722441-01 50 µL

HOXB9 polyclonal antibody

Sign In for Pricing
View Details