Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD7, Human (Biotinylated, HEK293, His-Avi)

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD7 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD7 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd7-protein-human-hek-293-his-avi.html

Smiles

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Molecular Formula

924 (Gene_ID) P09564 (A26-P180) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 405)
MBS6194839-01 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 405)

Sign In for Pricing
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 405)
MBS6194839-02 5x 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 405)

Sign In for Pricing
View Details
SOS2
335199 100 µL

SOS2

Sign In for Pricing
View Details
Tetrapeptide-21 Acetate
MBS5789753 Inquire

Tetrapeptide-21 Acetate

Sign In for Pricing
View Details
mAb anti-CA 125
MBS592245-01 0.1 mg

mAb anti-CA 125

Sign In for Pricing
View Details
mAb anti-CA 125
MBS592245-02 0.5 mg

mAb anti-CA 125

Sign In for Pricing
View Details