Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD7, Human (Biotinylated, HEK293, His-Avi)

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD7 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD7 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd7-protein-human-hek-293-his-avi.html

Smiles

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Molecular Formula

924 (Gene_ID) P09564 (A26-P180) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX7 Antibody (C-term) Blocking Peptide
MBS9222488-01 0.5 mg

SOX7 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
SOX7 Antibody (C-term) Blocking Peptide
MBS9222488-02 5x 0.5 mg

SOX7 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
TIMP1 Rabbit mAb
E45R12897N-50 50 µL

TIMP1 Rabbit mAb

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS516026 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
CBR4
enz-022 2µg

CBR4

Sign In for Pricing
View Details
d-Sydnocarb-D5
TRC-S920012-50MG 50 mg

d-Sydnocarb-D5

Sign In for Pricing
View Details