Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD7, Human (Biotinylated, HEK293, His-Avi)

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD7 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD7 Protein, Human (Biotinylated, HEK293, His-Avi), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd7-protein-human-hek-293-his-avi.html

Smiles

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Molecular Formula

924 (Gene_ID) P09564 (A26-P180) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RPIP8 Antibody [Alexa Fluor 647]
NBP2-97453AF647 0.1 mL

Rabbit Polyclonal RPIP8 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
TAF1C (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit C, RNA Polymerase I-specific TBP-associated Factor 110kD, TAFI110, TATA Box-binding Protein-associated Factor 1C, TBP-associated Factor 1C, Transcription Initiation Factor SL1/TIF-IB Subunit C) (MaxLight 750) discontinued
134187-ML750 100 µL

TAF1C (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit C, RNA Polymerase I-specific TBP-associated Factor 110kD, TAFI110, TATA Box-binding Protein-associated Factor 1C, TBP-associated Factor 1C, Transcription Initiation Factor SL1/TIF-IB Subunit C) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r180 shRNA (UAS) - Lentiviral mouse Vmn1r180 shRNA (UAS, GFP) (100)
GTR15218565 1 Vial

Lentiviral mouse Vmn1r180 shRNA (UAS) - Lentiviral mouse Vmn1r180 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RANGAP1, NT (RANGAP1, KIAA1835, SD, Ran GTPase-activating protein 1) (MaxLight 750) discontinued
040827-ML750 100 µL

RANGAP1, NT (RANGAP1, KIAA1835, SD, Ran GTPase-activating protein 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Human CCDC9B Protein
E30P5166 20 µg

Recombinant Human CCDC9B Protein

Sign In for Pricing
View Details
Olfr67 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3970007 1.0 µg DNA

Olfr67 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details