Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2/Mn-SOD, Human (HEK293, His)

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human (HEK293, His) is the recombinant human-derived SOD2/Mn-SOD protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOD2/Mn-SOD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sod2-protein-human-hek-293-his.html

Purity

99.90

Smiles

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Molecular Formula

6648 (Gene_ID) P04179 (K25-K222) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAL20 Recombinant Protein (Human)
RP104480 100 µg

TRNAL20 Recombinant Protein (Human)

Sign In for Pricing
View Details
Filamin C (FLNC) Antibody
abx404937-01 100 µL

Filamin C (FLNC) Antibody

Sign In for Pricing
View Details
Filamin C (FLNC) Antibody
abx404937-02 200 µL

Filamin C (FLNC) Antibody

Sign In for Pricing
View Details
Filamin C (FLNC) Antibody
abx404937-03 1 mL

Filamin C (FLNC) Antibody

Sign In for Pricing
View Details
CYBRD1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0543208 1.0 µg DNA

CYBRD1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque ACE-2 (C-Fc)
PHV2273-01 10 µg

Recombinant Rhesus Macaque ACE-2 (C-Fc)

Sign In for Pricing
View Details