Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2/Mn-SOD, Human (HEK293, His)

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human (HEK293, His) is the recombinant human-derived SOD2/Mn-SOD protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOD2/Mn-SOD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sod2-protein-human-hek-293-his.html

Purity

99.90

Smiles

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Molecular Formula

6648 (Gene_ID) P04179 (K25-K222) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Fc gamma RIII (CD16) Antibody (5B11) [PE/Cy7]
NBP2-42228PECY7 0.1 mL

Mouse Monoclonal Fc gamma RIII (CD16) Antibody (5B11) [PE/Cy7]

Sign In for Pricing
View Details
Amphiphysin I Rabbit Polyclonal Antibody
E53P03269 100 µL

Amphiphysin I Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Npr3 Mouse shRNA Plasmid (Locus ID 18162)
TL514036 1 Kit

Npr3 Mouse shRNA Plasmid (Locus ID 18162)

Sign In for Pricing
View Details
ZIKV Envelop domain III IgG Antibody ELISA Kit, Monkey
VACY-1022-CY681 1 Kit

ZIKV Envelop domain III IgG Antibody ELISA Kit, Monkey

Sign In for Pricing
View Details
ARHGEF10L (NM_001011722) Human Tagged ORF Clone
RG212664 10 µg

ARHGEF10L (NM_001011722) Human Tagged ORF Clone

Sign In for Pricing
View Details
Karyopherin Alpha 3 Blocking Peptide
33R-1141 100 ug

Karyopherin Alpha 3 Blocking Peptide

Sign In for Pricing
View Details