Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2/Mn-SOD, Human (HEK293, His)

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human (HEK293, His) is the recombinant human-derived SOD2/Mn-SOD protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOD2/Mn-SOD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sod2-protein-human-hek-293-his.html

Purity

99.90

Smiles

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Molecular Formula

6648 (Gene_ID) P04179 (K25-K222) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4302708 1.0 µg DNA

Olfr27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
RN5S248 ORF Vector (Human) (pORF)
ORF029144 1.0 µg DNA

RN5S248 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit anti-Lechevalieria aerocolonigenes (Nocardia aerocolonigenes)(Saccharothrix aerocolonigenes) REBD Polyclonal Antibody
MBS9016478 Inquire

Rabbit anti-Lechevalieria aerocolonigenes (Nocardia aerocolonigenes)(Saccharothrix aerocolonigenes) REBD Polyclonal Antibody

Sign In for Pricing
View Details
TMEM16A (ANO1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A3]
TA803590AM 100 µL

TMEM16A (ANO1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A3]

Sign In for Pricing
View Details
(1R) -3-Hydroxy-1-phenylpropylamine (Standard)
HY-34522R 1 Each

(1R) -3-Hydroxy-1-phenylpropylamine (Standard)

Sign In for Pricing
View Details
ANKZ1 Rabbit Polyclonal Antibody
JOT-AP01801-01 50ul

ANKZ1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details