Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2/Mn-SOD, Human (HEK293, His)

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human (HEK293, His) is the recombinant human-derived SOD2/Mn-SOD protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOD2/Mn-SOD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sod2-protein-human-hek-293-his.html

Purity

99.90

Smiles

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Molecular Formula

6648 (Gene_ID) P04179 (K25-K222) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 (NM_007315) Human Recombinant Protein
TP313858L 1 mg

STAT1 (NM_007315) Human Recombinant Protein

Sign In for Pricing
View Details
Sevelamer 5mg
A22030-5 5 mg

Sevelamer 5mg

Sign In for Pricing
View Details
ABHD3 Blocking Peptide
CBP3503-01 1 mg

ABHD3 Blocking Peptide

Sign In for Pricing
View Details
ABHD3 Blocking Peptide
CBP3503-02 5 mg

ABHD3 Blocking Peptide

Sign In for Pricing
View Details
LHX4 (LIM Homeobox 4, Gsh-4, Gsh4) (MaxLight 550)
248170-ML550 100 µL

LHX4 (LIM Homeobox 4, Gsh-4, Gsh4) (MaxLight 550)

Sign In for Pricing
View Details
Snx7 ORF Vector (Mouse) (pORF)
ORF058139 1.0 µg DNA

Snx7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details