Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2/Mn-SOD, Human (HEK293, His)

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human (HEK293, His) is the recombinant human-derived SOD2/Mn-SOD protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOD2/Mn-SOD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sod2-protein-human-hek-293-his.html

Purity

99.90

Smiles

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Molecular Formula

6648 (Gene_ID) P04179 (K25-K222) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase, 4'-phosphopantetheinyl Transferase, Alpha-aminoadipic Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase, AASD-PPT, LYS5 ortholog, CGI-80, HAH-P, HSPC223, x0005, DKFZp566E2346) (AP) discontinued
122786-AP 100 µL

AASDHPPT (L-aminoadipate-semialdehyde Dehydrogenase-phosphopantetheinyl Transferase, 4'-phosphopantetheinyl Transferase, Alpha-aminoadipic Semialdehyde Dehydrogenase-phosphopantetheinyl Transferase, AASD-PPT, LYS5 ortholog, CGI-80, HAH-P, HSPC223, x0005, DKFZp566E2346) (AP) discontinued

Sign In for Pricing
View Details
Goat anti-cytochrome P450 1A1 Antibody
MBS423384-01 0.1 mg

Goat anti-cytochrome P450 1A1 Antibody

Sign In for Pricing
View Details
Goat anti-cytochrome P450 1A1 Antibody
MBS423384-02 5x 0.1 mg

Goat anti-cytochrome P450 1A1 Antibody

Sign In for Pricing
View Details
Chicken Mucin 2 (MUC2) ELISA Kit-Sandwich
EK9F3-01 48 Test

Chicken Mucin 2 (MUC2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Chicken Mucin 2 (MUC2) ELISA Kit-Sandwich
EK9F3-02 96 Tests

Chicken Mucin 2 (MUC2) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Clptm1l Rat shRNA Plasmid (Locus ID 316916)
TL706779 1 Kit

Clptm1l Rat shRNA Plasmid (Locus ID 316916)

Sign In for Pricing
View Details