Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2/Mn-SOD, Human (HEK293, His)

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human (HEK293, His) is the recombinant human-derived SOD2/Mn-SOD protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOD2/Mn-SOD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sod2-protein-human-hek-293-his.html

Purity

99.90

Smiles

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Molecular Formula

6648 (Gene_ID) P04179 (K25-K222) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL17P36 sgRNA CRISPR Lentivector (Human) (Target 2)
K1915903 1.0 µg DNA

RPL17P36 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TSC2 siRNA Oligos set (Human)
48544171 3x 5 nmol

TSC2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
NRG2 (Pro-neuregulin-2, Membrane-bound Isoform, Pro-NRG2, NTAK, DKFZp434P086, MGC138699, pp9320, PP9320, TRG-16) (MaxLight 750)
MBS6234221-01 0.1 mL

NRG2 (Pro-neuregulin-2, Membrane-bound Isoform, Pro-NRG2, NTAK, DKFZp434P086, MGC138699, pp9320, PP9320, TRG-16) (MaxLight 750)

Sign In for Pricing
View Details
NRG2 (Pro-neuregulin-2, Membrane-bound Isoform, Pro-NRG2, NTAK, DKFZp434P086, MGC138699, pp9320, PP9320, TRG-16) (MaxLight 750)
MBS6234221-02 5x 0.1 mL

NRG2 (Pro-neuregulin-2, Membrane-bound Isoform, Pro-NRG2, NTAK, DKFZp434P086, MGC138699, pp9320, PP9320, TRG-16) (MaxLight 750)

Sign In for Pricing
View Details
TBX21 Rabbit Monoclonal Antibody
AMRe84506-01 1 Each

TBX21 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TBX21 Rabbit Monoclonal Antibody
AMRe84506-02 50 µL

TBX21 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details