Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOD2/Mn-SOD, Human (HEK293, His)

SOD2/Mn-SOD protein is a key enzyme in cellular defense that neutralizes superoxide anion radicals and protects cells from oxidative stress. SOD2, as a manganese-containing superoxide dismutase, plays a key role in breaking down these free radicals and is essential for maintaining cellular homeostasis and protecting biological systems from potential damage caused by the accumulation of reactive oxygen species. SOD2/Mn-SOD Protein, Human (HEK293, His) is the recombinant human-derived SOD2/Mn-SOD protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SOD2/Mn-SOD Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sod2-protein-human-hek-293-his.html

Purity

99.90

Smiles

KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Molecular Formula

6648 (Gene_ID) P04179 (K25-K222) (Accession)

Molecular Weight

Approximately 25.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vps37a (NM_033560) Mouse Tagged Lenti ORF Clone
MR215763L3 10 µg

Vps37a (NM_033560) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PNLIP (6T18) Mouse Monoclonal antibody
E28PE0539 100 µL

PNLIP (6T18) Mouse Monoclonal antibody

Sign In for Pricing
View Details
TAGLN (Transgelin, DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10) (PE)
252361-PE 100 µL

TAGLN (Transgelin, DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10) (PE)

Sign In for Pricing
View Details
HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (MaxLight 550)
MBS6211944-01 0.1 mL

HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (MaxLight 550)

Sign In for Pricing
View Details
HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (MaxLight 550)
MBS6211944-02 5x 0.1 mL

HOXC5 (Homeobox Protein Hox-C5, Homeobox Protein CP11, Homeobox Protein Hox-3D, HOX3D) (MaxLight 550)

Sign In for Pricing
View Details
TPRKB Human Pre-designed siRNA Set A
HY-RS14949 1 Set

TPRKB Human Pre-designed siRNA Set A

Sign In for Pricing
View Details