IL-17RE, Mouse (HEK293, His)

AQPSAAEGREHLPEAGSQKCGGPEFSFDLLPEVQAVRVTIPAGPKASVRLCYQWALECEDLSSPFDTQKIVSGGHTVDLPYEFLLPCMCIEASYLQEDTVRRKKCPFQSWPEAYGSDFWQSIRFTDYSQHNQMVMALTLRCPLKLEASLCWRQDPLTPCETLPNATAQESEGWYILENVDLHPQLCFKFSFENSSHVECPHQSGSLPSWTVSMDTQAQQLTLHFSSRTYATFSAAWSDPGLGPDTPMPPVYSISQTQGSVPVTLDLIIPFLRQENCILVWRSDVHFAWKHVLCPDVSHRH

[1]Giovanna Vella, et al. The IL-17 receptor IL-17RE mediates polyIC-induced exacerbation of experimental allergic asthma. Respir Res. 2020 Jul 8;21 (1) :176.|[2]Jasper F Nies, et al. IL-17C/IL-17RE: Emergence of a Unique Axis in TH17 Biology. Front Immunol. 2020 Feb 26;11:341.|[3]Xinyang Song, et al. IL-17RE is the functional receptor for IL-17C and mediates mucosal immunity to infection with intestinal pathogens. Nat Immunol. 2011 Oct 12;12 (12) :1151-8.|[4]Caini Liu, et al. The flavonoid cyanidin blocks binding of the cytokine interleukin-17A to the IL-17RA subunit to alleviate inflammation in vivo. Sci Signal. 2017 Feb 21;10 (467) :eaaf8823.