MIP-3 alpha/CCL20, Human (His)

MIP-3 alpha/CCL20 Protein, Human (His) is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Human (His) is a recombinant human CCL20 (A27-M96) expressed by E. coli with six-His tags at the N-terminus[1].

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-human-his.html

Purity

95.00

Smiles

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Molecular Formula

6364 (Gene_ID) P78556-1 (A27-M96) (Accession)

Molecular Weight

Approximately 10-12 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Louis Boafo Kwantwi, et al. Multifaceted roles of CCL20 (C-C motif chemokine ligand 20) : mechanisms and communication networks in breast cancer progression. Bioengineered. 2021 Dec;12 (1) :6923-6934.|[2]M Baba, et al. Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC. J Biol Chem. 1997 Jun 6;272 (23) :14893-8.|[3]M Soledad Hielpos, et al. CCL20 and Beta-Defensin 2 Production by Human Lung Epithelial Cells and Macrophages in Response to Brucella abortus Infection. PLoS One. 2015 Oct 8;10 (10) :e0140408.|[4]A Izadpanah, et al. Regulated MIP-3alpha/CCL20 production by human intestinal epithelium: mechanism for modulating mucosal immunity. Am J Physiol Gastrointest Liver Physiol. 2001 Apr;280 (4) :G710-9.