CRMP1, Human
The CRMP1 protein is indispensable for class 3 semaphorin-mediated signaling that drives cytoskeletal remodeling critical for axonal guidance. CRMP1 downstream of SEMA3A induces FLNA dissociation from F-actin, promoting actin cytoskeleton reorganization and growth cone collapse. CRMP1 Protein, Human is the recombinant human-derived CRMP1 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
CRMP1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/crmp1-protein-human.html
Purity
90.00
Smiles
MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
Molecular Formula
1400 (Gene_ID) Q14194 (M1-G572) (Accession)
Molecular Weight
Approximately 62.2 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0255802 1.0 µg DNA
C7orf51 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
31893116 3x 1.0 µg
Nle1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details bs-42393R-PE-Cy5.5 100 µL
MADCAM1 Polyclonal Antibody, PE-Cy5.5 Conjugated
Sign In for Pricing
View Details 