Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Chemokine C-C-Motif Ligand 14 CCL14 ELISA Kit
BG-POR10610 1 Each

Porcine Chemokine C-C-Motif Ligand 14 CCL14 ELISA Kit

Sign In for Pricing
View Details
Roundabout 4 Antibody
abx032411-01 80 µL

Roundabout 4 Antibody

Sign In for Pricing
View Details
Roundabout 4 Antibody
abx032411-02 400 µL

Roundabout 4 Antibody

Sign In for Pricing
View Details
Monoclonal Anti-Human CD3 Antibody, Mouse IgG1 (UCHT1)
CDE-M532-1mg 1 mg

Monoclonal Anti-Human CD3 Antibody, Mouse IgG1 (UCHT1)

Sign In for Pricing
View Details
CCRL1P siRNA Oligos set (Human)
54308171 3x 5 nmol

CCRL1P siRNA Oligos set (Human)

Sign In for Pricing
View Details
Mouse Homocysteine, Hcy ELISA Kit
CK-bio-16375-01 48 Tests

Mouse Homocysteine, Hcy ELISA Kit

Sign In for Pricing
View Details