Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2BJ, CT (HIST1H2BJ, H2BFR, Histone H2B type 1-J, Histone H2B.1, Histone H2B.r, HIST1H2BK, HIST3H2BB) (PE) discontinued
036595-PE 200 µL

HIST1H2BJ, CT (HIST1H2BJ, H2BFR, Histone H2B type 1-J, Histone H2B.1, Histone H2B.r, HIST1H2BK, HIST3H2BB) (PE) discontinued

Sign In for Pricing
View Details
Anti-Pseudomonas aeruginosa xcpQ Nanobody (SAA2260)
JN102013-01 50 µg

Anti-Pseudomonas aeruginosa xcpQ Nanobody (SAA2260)

Sign In for Pricing
View Details
Anti-Pseudomonas aeruginosa xcpQ Nanobody (SAA2260)
JN102013-02 100 µg

Anti-Pseudomonas aeruginosa xcpQ Nanobody (SAA2260)

Sign In for Pricing
View Details
Anti-Pseudomonas aeruginosa xcpQ Nanobody (SAA2260)
JN102013-03 1 mg

Anti-Pseudomonas aeruginosa xcpQ Nanobody (SAA2260)

Sign In for Pricing
View Details
Rat Lhfpl2 Pre-designed siRNA Set B
SI207595B 1 Each

Rat Lhfpl2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human Protein RMD5 homolog B, RMND5B ELISA KIT
ELI-38859h 96 Tests

Human Protein RMD5 homolog B, RMND5B ELISA KIT

Sign In for Pricing
View Details