CTLA-4, Rhesus Macaque (HEK293, His)
CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html
Purity
95.00
Smiles
AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD
Molecular Formula
705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)
Molecular Weight
Approximately 25-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Mouse Anti Human Epithelial Cell Adhesion Molecule
Mouse Anti Human Epithelial Cell Adhesion Molecule
Mouse Anti Human Epithelial Cell Adhesion Molecule
Mouse Anti Human Epithelial Cell Adhesion Molecule