Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU6-4 siRNA Oligos set (Human)
40462171 3x 5 nmol

RNU6-4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
AKR7A2 3'UTR Luciferase Stable Cell Line
TU000584 1.0 mL

AKR7A2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SDPR Protein Vector (Rat) (pPM-C-HA)
43268026 500 ng

SDPR Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-MMP-9 Antibody, Rabbit Polyclonal
MBS8111745-01 0.1 mL

Anti-MMP-9 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-MMP-9 Antibody, Rabbit Polyclonal
MBS8111745-02 5x 0.1 mL

Anti-MMP-9 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Lentiviral mouse Mcoln2 shRNA (UAS) - Lentiviral mouse Mcoln2 shRNA (UAS) plasmid
GTR15280735 1 Vial

Lentiviral mouse Mcoln2 shRNA (UAS) - Lentiviral mouse Mcoln2 shRNA (UAS) plasmid

Sign In for Pricing
View Details