Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamine-rich 2 shRNA (m) Lentiviral Particles
sc-145453-V 200 µL

Glutamine-rich 2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Human S100A7A Protein, N-GST
E55P2661 50 µg

Recombinant Human S100A7A Protein, N-GST

Sign In for Pricing
View Details
Recombinant Shigella Sonnei SSON_3516 Protein (aa 1-252)
VAng-0212Lsx-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei SSON_3516 Protein (aa 1-252)

Sign In for Pricing
View Details
PTPN7 Human shRNA Plasmid Kit (Locus ID 5778)
TR316685 1 Kit

PTPN7 Human shRNA Plasmid Kit (Locus ID 5778)

Sign In for Pricing
View Details
PLV3-CMV-3xFLAG-CDH22-EF1-CopGFP-T2A-Puro Plasmid
PVT79176 2 µg

PLV3-CMV-3xFLAG-CDH22-EF1-CopGFP-T2A-Puro Plasmid

Sign In for Pricing
View Details
RPL36AP51 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1983605 3x 1.0 µg

RPL36AP51 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details