CTLA-4, Rhesus Macaque (HEK293, His)
CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html
Purity
95.00
Smiles
AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD
Molecular Formula
705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)
Molecular Weight
Approximately 25-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Magic™ Membrane Protein Human NPY2R (Neuropeptide Y receptor Y2) Expressed in vitro E.coli expression system, Full Length
Anxa6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1, PAPS Synthethase 1, Sulfurylase Kinase 1, SK1, SK 1, ATPSK1, PAPSS) (Biotin)
PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthethase 1, PAPS Synthethase 1, Sulfurylase Kinase 1, SK1, SK 1, ATPSK1, PAPSS) (Biotin)