Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody
TA342633 100 µL

Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tumor protein p63-regulated gene 1-Like protein (TPRG1L) Bovine ELISA Kit
H9538 96 Tests

Tumor protein p63-regulated gene 1-Like protein (TPRG1L) Bovine ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SRO1 Polyclonal Antibody
MBS7182593 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SRO1 Polyclonal Antibody

Sign In for Pricing
View Details
DEFB108P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV759918 1.0 µg DNA

DEFB108P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Purified Glutathione S-Transferase P (GSTp) CHO-S
MBS560901-01 0.1 mg

Purified Glutathione S-Transferase P (GSTp) CHO-S

Sign In for Pricing
View Details
Purified Glutathione S-Transferase P (GSTp) CHO-S
MBS560901-02 5x 0.1 mg

Purified Glutathione S-Transferase P (GSTp) CHO-S

Sign In for Pricing
View Details