Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMPRSS2 Polyclonal Antibody
PHA51501 100 μg

Anti-TMPRSS2 Polyclonal Antibody

Sign In for Pricing
View Details
ATG3 sgRNA CRISPR Lentivector (Human) (Target 3)
K0141804 1.0 µg DNA

ATG3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human POU3F2 siRNA
abx904145-01 15 nmol

Human POU3F2 siRNA

Sign In for Pricing
View Details
Human POU3F2 siRNA
abx904145-02 30 nmol

Human POU3F2 siRNA

Sign In for Pricing
View Details
Ethyl ziram
Z2190-01 100 g

Ethyl ziram

Sign In for Pricing
View Details
Ethyl ziram
Z2190-02 25 g

Ethyl ziram

Sign In for Pricing
View Details