Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C Kit (KIT) Mouse Monoclonal Antibody [Clone ID: LBI3F9]
AMM14927VCF 100 µg

C Kit (KIT) Mouse Monoclonal Antibody [Clone ID: LBI3F9]

Sign In for Pricing
View Details
MT I
hor-306 20mg

MT I

Sign In for Pricing
View Details
RFC1 (RFC140, Replication Factor C Subunit 1, Activator 1 140kD Subunit, Activator 1 Large Subunit, Activator 1 Subunit 1, DNA-binding Protein PO-GA, Replication Factor C 140kD Subunit, Replication Factor C Large Subunit, MGC51786) (Biotin)
132487-Biotin 100 µL

RFC1 (RFC140, Replication Factor C Subunit 1, Activator 1 140kD Subunit, Activator 1 Large Subunit, Activator 1 Subunit 1, DNA-binding Protein PO-GA, Replication Factor C 140kD Subunit, Replication Factor C Large Subunit, MGC51786) (Biotin)

Sign In for Pricing
View Details
Hsa-miR-6807-3p miRNA Mimic
CMH2278-01 5 nmol

Hsa-miR-6807-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-6807-3p miRNA Mimic
CMH2278-02 10 nmol

Hsa-miR-6807-3p miRNA Mimic

Sign In for Pricing
View Details
ZP2 Polyclonal Antibody
ABP56554-01 30 µL

ZP2 Polyclonal Antibody

Sign In for Pricing
View Details