Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGES Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV729358 1.0 µg DNA

IGES Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
ERBB3 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (avian), ErbB-3, HER3, LCCS2, MDA-BF-1, MGC88033, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3) (AP) discontinued
245811-AP 100 µL

ERBB3 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 3 (avian), ErbB-3, HER3, LCCS2, MDA-BF-1, MGC88033, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal HEY1 Antibody
NBP3-35645-20ul 20 µL

Rabbit Polyclonal HEY1 Antibody

Sign In for Pricing
View Details
Bola2 ORF Vector (Mouse) (pORF)
ORF039922 1.0 µg DNA

Bola2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Human Metastasis-suppressor KiSS-1 (KISS1)
MBS1391706-01 0.02 mg (E-Coli)

Recombinant Human Metastasis-suppressor KiSS-1 (KISS1)

Sign In for Pricing
View Details
Recombinant Human Metastasis-suppressor KiSS-1 (KISS1)
MBS1391706-02 0.1 mg (E-Coli)

Recombinant Human Metastasis-suppressor KiSS-1 (KISS1)

Sign In for Pricing
View Details