Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Rhesus Macaque (HEK293, His)

CTLA-4 protein acts as a primary inhibitory receptor, playing a major role in regulating T-cell responses. Its strong affinity for CD80 and CD86 receptors allows CTLA-4 to effectively suppress T-cell activation and maintain immune balance. This interplay is crucial for fine-tuning T-cell-mediated immunity. CTLA-4 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-cynomolgus-rhesus-macaque-hek293-his.html

Purity

95.00

Smiles

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSD

Molecular Formula

705673 (Gene_ID) Q9BDC4 (A37-D161) (Accession)

Molecular Weight

Approximately 25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Cel Plasmid
PVT53675 2 µg

pCMV-SPORT6-Cel Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Xkrx shRNA (UAS) - Lentiviral mouse Xkrx shRNA (UAS, iRFP) plasmid
GTR15264916 1 Vial

Lentiviral mouse Xkrx shRNA (UAS) - Lentiviral mouse Xkrx shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal CD58/LFA-3 Antibody (TS2/9) [DyLight 594]
NBP2-22542DL594 0.2 mL

Mouse Monoclonal CD58/LFA-3 Antibody (TS2/9) [DyLight 594]

Sign In for Pricing
View Details
Platelet Glycoprotein IX (GP9) Antibody
abx377720-01 50 µg

Platelet Glycoprotein IX (GP9) Antibody

Sign In for Pricing
View Details
Platelet Glycoprotein IX (GP9) Antibody
abx377720-02 100 µg

Platelet Glycoprotein IX (GP9) Antibody

Sign In for Pricing
View Details
CHIL3 Protein (N-His, Mus musculus (Mouse) )
P502530 100 µg

CHIL3 Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details