Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SINHCAF, Human (GST)

SINHCAF is a key subunit of the Sin3 deacetylase complex (Sin3/HDAC) and is essential for inhibiting genes related to the TGF-β signaling pathway. In embryonic stem (ES) cells, SINHCAF forms the SIN3A complex together with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. SINHCAF Protein, Human (GST) is the recombinant human-derived SINHCAF protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

SINHCAF Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sinhcaf-protein-human-gst.html

Smiles

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Molecular Formula

58516 (Gene_ID) Q9NP50-1 (M1-W221) (Accession)

Molecular Weight

51.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBD1 (NM_001193610) Human Over-expression Lysate
LY434206 100 µg

TUBD1 (NM_001193610) Human Over-expression Lysate

Sign In for Pricing
View Details
D-Mannuronic Acid Sodium Salt
TRC-D208470-250MG 250 mg

D-Mannuronic Acid Sodium Salt

Sign In for Pricing
View Details
BAD Rabbit Polyclonal Antibody
AP20966PU-N 100 µg

BAD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559753 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
2-Chloro-5-formylbenzoic Acid
TRC-C197676-1G 1 g

2-Chloro-5-formylbenzoic Acid

Sign In for Pricing
View Details
Hexamidine Dihydrochloride
TRC-H294205-10MG 10 mg

Hexamidine Dihydrochloride

Sign In for Pricing
View Details