Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGPRT, Human (His)

HGPRT proteins play a key role in purine metabolism, promoting the conversion of guanine to guanosine monophosphate and hypoxanthine to inosine monophosphate. Through its enzymatic activity, HGPRT transfers the 5-phosphate ribosyl group from 5-phosphate ribose pyrophosphate to purine, making a significant contribution to the purine salvage pathway. HGPRT Protein, Human (His) is the recombinant human-derived HGPRT protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HGPRT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hgprt-protein-human-his.html

Purity

96.00

Smiles

MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

Molecular Formula

3251 (Gene_ID) P00492 (M1-A218) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MYOZ1 (Myozenin 1, Myozenin-1, Calsarcin-2, MYOZ Filamin-, actinin- and telethonin-binding Protein, Protein FATZ) APC
MBS6137769-01 0.1 mL

MYOZ1 (Myozenin 1, Myozenin-1, Calsarcin-2, MYOZ Filamin-, actinin- and telethonin-binding Protein, Protein FATZ) APC

Ask
View Details
MYOZ1 (Myozenin 1, Myozenin-1, Calsarcin-2, MYOZ Filamin-, actinin- and telethonin-binding Protein, Protein FATZ) APC
MBS6137769-02 5x 0.1 mL

MYOZ1 (Myozenin 1, Myozenin-1, Calsarcin-2, MYOZ Filamin-, actinin- and telethonin-binding Protein, Protein FATZ) APC

Ask
View Details
Tau Rabbit Monoclonal Antibody (Capture)
E56PA0729 100 µL

Tau Rabbit Monoclonal Antibody (Capture)

Ask
View Details
Bovine ACTR3/Actin-related protein 3 ELISA Kit
MBS2904440-01 48 Well

Bovine ACTR3/Actin-related protein 3 ELISA Kit

Ask
View Details
Bovine ACTR3/Actin-related protein 3 ELISA Kit
MBS2904440-02 96 Well

Bovine ACTR3/Actin-related protein 3 ELISA Kit

Ask
View Details
Bovine ACTR3/Actin-related protein 3 ELISA Kit
MBS2904440-03 5x 96 Well

Bovine ACTR3/Actin-related protein 3 ELISA Kit

Ask
View Details