Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Rat (CHO)

EGF Protein, Rat (CHO) is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Product Specifications

Product Name Alternative

EGF Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-rat-cho.html

Purity

95.0

Smiles

MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Formula

25313 (Gene_ID) P07522 (N974-R1026) (Accession)

Molecular Weight

Approximately 6 kDa

References & Citations

[1]Palencia L, et al. Epidermal growth factor mediated healing in stem cell-derived vocal fold mucosa. J Surg Res. 2015 Jul;197 (1) :32-8.|[2]Choi SY, et al. Epidermal Growth Factor Relieves Inflammatory Signals in Staphylococcus aureus-Treated Human Epidermal Keratinocytes and Atopic Dermatitis-Like Skin Lesions in Nc/Nga Mice. Biomed Res Int. 2018 May 15;2018:9439182.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ADCK4 (Uncharacterized aarF Domain-containing Protein Kinase 4, FLJ12229)
122994 100 µg

ADCK4 (Uncharacterized aarF Domain-containing Protein Kinase 4, FLJ12229)

Ask
View Details
Fam219a (NM_001159583) Mouse Tagged ORF Clone
MG213525 10 µg

Fam219a (NM_001159583) Mouse Tagged ORF Clone

Ask
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (AP)
MBS6165645-01 0.1 mL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (AP)

Ask
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (AP)
MBS6165645-02 5x 0.1 mL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (AP)

Ask
View Details
Human PPBPP1 qPCR Primer Pair
QH81845S 200 Tests

Human PPBPP1 qPCR Primer Pair

Ask
View Details