TNF-beta/TNFSF1, Human (HEK293, His)
TNF-β protein acts as a homotrimeric cytokine that binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM. TNF-beta/TNFSF1 Protein, Human (HEK293, His) is the recombinant human-derived TNF-beta/TNFSF1 protein, expressed by HEK293 , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
TNF-beta/TNFSF1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/lymphotoxin-alpha-lta-protein-human-hek293-his.html
Purity
95.00
Smiles
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Molecular Formula
4049 (Gene_ID) P01374 (L35-L205) (Accession)
Molecular Weight
Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7272062-01 48 Well
Monkey Soluble toll like receptor 9 ELISA Kit
Sign In for Pricing
View Details MBS7272062-02 96 Well
Monkey Soluble toll like receptor 9 ELISA Kit
Sign In for Pricing
View Details MBS7272062-03 5x 96 Well
Monkey Soluble toll like receptor 9 ELISA Kit
Sign In for Pricing
View Details MBS7272062-04 10x 96 Well
Monkey Soluble toll like receptor 9 ELISA Kit
Sign In for Pricing
View Details TA504035 100 µL
Nucleobindin 1 (NUCB1) Mouse Monoclonal Antibody [Clone ID: OTI1G3]
Sign In for Pricing
View Details