Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-beta/TNFSF1, Human (HEK293, His)

TNF-β protein acts as a homotrimeric cytokine that binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM. TNF-beta/TNFSF1 Protein, Human (HEK293, His) is the recombinant human-derived TNF-beta/TNFSF1 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-beta/TNFSF1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lymphotoxin-alpha-lta-protein-human-hek293-his.html

Purity

95.00

Smiles

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Molecular Formula

4049 (Gene_ID) P01374 (L35-L205) (Accession)

Molecular Weight

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit TSH ELISA Kit
EKU12858 96 Tests

Rabbit TSH ELISA Kit

Sign In for Pricing
View Details
Gm17689 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3810904 1.0 µg DNA

Gm17689 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Standard Nutrient  Agar No.2
72899-1 500 Gms

Standard Nutrient Agar No.2

Sign In for Pricing
View Details
Grin2d (NM_008172) Mouse Tagged ORF Clone
MG220972 10 µg

Grin2d (NM_008172) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse YOD1 ELISA Kit
E111033 1 Each

Mouse YOD1 ELISA Kit

Sign In for Pricing
View Details
Rpp25 (NM_133982) Mouse Recombinant Protein
PM48364M5 20 µg

Rpp25 (NM_133982) Mouse Recombinant Protein

Sign In for Pricing
View Details