Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAK3, Human (His)

Product Specifications

UNSPSC Description

JAK3 Protein, Human (His) is the recombinant human-derived JAK3, expressed by E. coli , with C-6*His labeled tag. ,

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jak3-protein-human-his.html

Purity

98.0

Smiles

MEVFSGVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIAD

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP110 Antibody / SP110 nuclear body protein
FY13102 100 µg

SP110 Antibody / SP110 nuclear body protein

Sign In for Pricing
View Details
ZC3H15 (NM_018471) Human Over-expression Lysate
LS055854-100ug 100 µg

ZC3H15 (NM_018471) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-PPP2CB Antibody
CQA2170-01 30 µL

Anti-PPP2CB Antibody

Sign In for Pricing
View Details
Anti-PPP2CB Antibody
CQA2170-02 50 μL

Anti-PPP2CB Antibody

Sign In for Pricing
View Details
Anti-PPP2CB Antibody
CQA2170-03 100 µL

Anti-PPP2CB Antibody

Sign In for Pricing
View Details
Anti-PPP2CB Antibody
CQA2170-04 200 µL

Anti-PPP2CB Antibody

Sign In for Pricing
View Details