Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGR, Human (G365S, HEK293, His)

PIGR proteins play a critical role in mediating the selective transcytosis of polymerized IgA and IgM across mucosal epithelial cells, which is critical for mucosal immunity. PIGR binds these immunoglobulins at the basolateral surface, forming a complex that is transported intracellularly and secreted apically. PIGR Protein, Human (G365S, HEK293, His) is the recombinant human-derived PIGR protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PIGR Protein, Human (G365S, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pigr-protein-human-hek-293-his.html

Purity

95.0

Smiles

KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVADTRDQADGSRASVDSGSSEEQGGSSR

Molecular Formula

5284 (Gene_ID) P01833/NP_002635.2 (K19-R638, G365S) (Accession)

Molecular Weight

Approximately 88.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 6 monoclonal antibody (3D10)
ENZ-ABS750-0200 200 µg

Syntaxin 6 monoclonal antibody (3D10)

Sign In for Pricing
View Details
Hsa-miR-219a-1-3p miRNA Agomir
orb1921035-01 5 nmol

Hsa-miR-219a-1-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-219a-1-3p miRNA Agomir
orb1921035-02 10 nmol

Hsa-miR-219a-1-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-219a-1-3p miRNA Agomir
orb1921035-03 20 nmol

Hsa-miR-219a-1-3p miRNA Agomir

Sign In for Pricing
View Details
UGT8 Antibody
R34802-100UG 100 µg

UGT8 Antibody

Sign In for Pricing
View Details
Phospho-STMN1 (Ser16) Rabbit Polyclonal Antibody (Cy7)
orb1047349 100 µL

Phospho-STMN1 (Ser16) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details