Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD4, Human (His)

PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDCD4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdcd4-protein-human-his.html

Purity

95.0

Smiles

KASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVP

Molecular Formula

27250 (Gene_ID) Q53EL6 (K212-P357) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Lactic acid
S6250-25ul 25 µL

L-Lactic acid

Sign In for Pricing
View Details
Rabbit Anti-C19orf18 antibody
SL9677R-01 50 µL

Rabbit Anti-C19orf18 antibody

Sign In for Pricing
View Details
Rabbit Anti-C19orf18 antibody
SL9677R-02 100 µL

Rabbit Anti-C19orf18 antibody

Sign In for Pricing
View Details
Mouse Monoclonal Prohibitin Antibody (PHB/3230) [HRP]
NBP3-08687H 100 µL

Mouse Monoclonal Prohibitin Antibody (PHB/3230) [HRP]

Sign In for Pricing
View Details
Recombinant Emericella nidulans NADH-cytochrome b5 reductase 2 (mcr1), partial
MBS7082957 Inquire

Recombinant Emericella nidulans NADH-cytochrome b5 reductase 2 (mcr1), partial

Sign In for Pricing
View Details
AKR1B1 (aldo-keto Reductase Family 1, Member B1 (aldose Reductase), ADR, ALDR1, ALR2, AR, MGC1804) (MaxLight 750)
MBS6450473-01 0.1 mL

AKR1B1 (aldo-keto Reductase Family 1, Member B1 (aldose Reductase), ADR, ALDR1, ALR2, AR, MGC1804) (MaxLight 750)

Sign In for Pricing
View Details