Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDCD4, Human (His)

PDCD4 inhibits translation initiation by disrupting the EIF4A1-EIF4G interaction and inhibiting EIF4A helicase activity. It regulates JUN kinase activation and downregulates MAP4K1, inhibiting invasion and tumorigenesis. PDCD4 Protein, Human (His) is the recombinant human-derived PDCD4 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PDCD4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdcd4-protein-human-his.html

Purity

95.0

Smiles

KASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVP

Molecular Formula

27250 (Gene_ID) Q53EL6 (K212-P357) (Accession)

Molecular Weight

Approximately 17.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2H Protein, Human, Recombinant (GST)
TMPJ-01047-01 10 µg

UBE2H Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
UBE2H Protein, Human, Recombinant (GST)
TMPJ-01047-02 20 µg

UBE2H Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
UBE2H Protein, Human, Recombinant (GST)
TMPJ-01047-03 50 µg

UBE2H Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
UBE2H Protein, Human, Recombinant (GST)
TMPJ-01047-04 100 µg

UBE2H Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
UBE2H Protein, Human, Recombinant (GST)
TMPJ-01047-05 200 µg

UBE2H Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
UBE2H Protein, Human, Recombinant (GST)
TMPJ-01047-06 500 µg

UBE2H Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details