Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Human (HEK293, mFc, solution)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, mFc, solution) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Human (HEK293, mFc, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-mfc-solution.html

Smiles

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Formula

2267 (Gene_ID) Q08830 (L23-I312) (Accession)

Molecular Weight

Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GABA A Receptor alpha 3 (GABRA3) Human qPCR Primer Pair (NM_000808)
HP200749 200 Reactions

GABA A Receptor alpha 3 (GABRA3) Human qPCR Primer Pair (NM_000808)

Ask
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)
MBS2116192-01 0.1 mL

HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)

Ask
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)
MBS2116192-02 0.2 mL

HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)

Ask
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)
MBS2116192-03 0.5 mL

HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)

Ask
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)
MBS2116192-04 1 mL

HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)

Ask
View Details
HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)
MBS2116192-05 5 mL

HRP-Linked Polyclonal Antibody to Kallikrein 13 (KLK13)

Ask
View Details