MMP-9, Human (HEK293, His, solution)
The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration. It is suggested that it may be involved in bone osteoclastic resorption. MMP-9 Protein, Human (HEK293, His, solution) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MMP-9 Protein, Human (HEK293, His, solution), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mmp-9-protein-human-hek-293-his.html
Purity
99.00
Smiles
AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Molecular Formula
4318 (Gene_ID) AAH06093.1 (A19-D707) (Accession)
Molecular Weight
Approximately 90.0 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400096-100 1x 100 µL
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880029-500 1x 500 µL
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 