Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Human (HEK293, His)

ST6GAL1, a pivotal enzyme, facilitates glycosylation by transferring sialic acid from CMP-sialic acid to galactose-containing acceptor substrates. ST6GAL1 Protein, Human (HEK293, His) is the recombinant human-derived ST6GAL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-human-hek-293-his.html

Purity

98.0

Smiles

KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Molecular Formula

6480 (Gene_ID) P15907 (K27-C406) (Accession)

Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGTB CRISPRa sgRNA lentivector (set of three targets)(Rat)
43646126 3x 1.0µg DNA

SGTB CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
GSTK1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62048R-BF555-01 20 µL

GSTK1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
GSTK1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62048R-BF555-02 100 µL

GSTK1 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Bovine follicle-stimulating hormone, FSH ELISA Kit
MBS705623-01 24 Well (LIMIT 1)

Bovine follicle-stimulating hormone, FSH ELISA Kit

Sign In for Pricing
View Details
Bovine follicle-stimulating hormone, FSH ELISA Kit
MBS705623-02 48 Well

Bovine follicle-stimulating hormone, FSH ELISA Kit

Sign In for Pricing
View Details
Bovine follicle-stimulating hormone, FSH ELISA Kit
MBS705623-03 96 Well

Bovine follicle-stimulating hormone, FSH ELISA Kit

Sign In for Pricing
View Details