Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST6GAL1, Human (HEK293, His)

ST6GAL1, a pivotal enzyme, facilitates glycosylation by transferring sialic acid from CMP-sialic acid to galactose-containing acceptor substrates. ST6GAL1 Protein, Human (HEK293, His) is the recombinant human-derived ST6GAL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ST6GAL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/st6gal1-protein-human-hek-293-his.html

Purity

98.0

Smiles

KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC

Molecular Formula

6480 (Gene_ID) P15907 (K27-C406) (Accession)

Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLI2 Rabbit pAb
MBS8546152-01 0.1 mL

GLI2 Rabbit pAb

Sign In for Pricing
View Details
GLI2 Rabbit pAb
MBS8546152-02 0.1 mL (AF405L)

GLI2 Rabbit pAb

Sign In for Pricing
View Details
GLI2 Rabbit pAb
MBS8546152-03 0.1 mL (AF405S)

GLI2 Rabbit pAb

Sign In for Pricing
View Details
GLI2 Rabbit pAb
MBS8546152-04 0.1 mL (AF610)

GLI2 Rabbit pAb

Sign In for Pricing
View Details
GLI2 Rabbit pAb
MBS8546152-05 0.1 mL (AF635)

GLI2 Rabbit pAb

Sign In for Pricing
View Details
GLI2 Rabbit pAb
MBS8546152-06 0.1 mL (APC)

GLI2 Rabbit pAb

Sign In for Pricing
View Details