ST6GAL1, Human (HEK293, His)
ST6GAL1, a pivotal enzyme, facilitates glycosylation by transferring sialic acid from CMP-sialic acid to galactose-containing acceptor substrates. ST6GAL1 Protein, Human (HEK293, His) is the recombinant human-derived ST6GAL1 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
ST6GAL1 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/st6gal1-protein-human-hek-293-his.html
Purity
98.0
Smiles
KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Molecular Formula
6480 (Gene_ID) P15907 (K27-C406) (Accession)
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV784723 1.0 µg DNA
RPS27P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 
PT_73139-01 2 µg
Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 Human Recombinant, Sf9 (LYVE1 Human Sf9)
Sign In for Pricing
View Details 
PT_73139-02 10 µg
Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 Human Recombinant, Sf9 (LYVE1 Human Sf9)
Sign In for Pricing
View Details PT_73139-03 1 mg
Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1 Human Recombinant, Sf9 (LYVE1 Human Sf9)
Sign In for Pricing
View Details MBS1568523-01 0.1 mg
Anti-HRSV-A F/Fusion glycoprotein F0 Antibody (101F)
Sign In for Pricing
View Details MBS1568523-02 1 mg
Anti-HRSV-A F/Fusion glycoprotein F0 Antibody (101F)
Sign In for Pricing
View Details