Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP SCF, Human (HEK293, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. GMP SCF Protein, Human (HEK293, His) is the recombinant human-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP SCF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-scf-protein-human-hek-293-his.html

Purity

95.0

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-H214) (Accession)

Molecular Weight

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP-1alpha) ELISA kit
MBS2601749-01 48 Well

Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP-1alpha) ELISA kit

Sign In for Pricing
View Details
Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP-1alpha) ELISA kit
MBS2601749-02 96 Well

Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP-1alpha) ELISA kit

Sign In for Pricing
View Details
Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP-1alpha) ELISA kit
MBS2601749-03 5x 96 Well

Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP-1alpha) ELISA kit

Sign In for Pricing
View Details
Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP-1alpha) ELISA kit
MBS2601749-04 10x 96 Well

Rabbit Macrophage Inflammatory Protein 1 Alpha (MIP-1alpha) ELISA kit

Sign In for Pricing
View Details
Mouse CXCL12 Protein, His tag (Animal-Free)
PRP1187-01 1 mg

Mouse CXCL12 Protein, His tag (Animal-Free)

Sign In for Pricing
View Details
Mouse CXCL12 Protein, His tag (Animal-Free)
PRP1187-02 5 µg

Mouse CXCL12 Protein, His tag (Animal-Free)

Sign In for Pricing
View Details