Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP SCF, Human (HEK293, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. GMP SCF Protein, Human (HEK293, His) is the recombinant human-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP SCF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-scf-protein-human-hek-293-his.html

Purity

95.0

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-H214) (Accession)

Molecular Weight

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC220594 (TL132 Protein, FLJ98241) (MaxLight 405) discontinued
129161-ML405 100 µL

LOC220594 (TL132 Protein, FLJ98241) (MaxLight 405) discontinued

Sign In for Pricing
View Details
UQCRH Protein Vector (Human) (pPM-C-HA)
PV045375 500 ng

UQCRH Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis G-protein coupled receptor 1 (GPR1)
MBS7016050-01 0.02 mg

Recombinant Macaca fascicularis G-protein coupled receptor 1 (GPR1)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis G-protein coupled receptor 1 (GPR1)
MBS7016050-02 0.1 mg

Recombinant Macaca fascicularis G-protein coupled receptor 1 (GPR1)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis G-protein coupled receptor 1 (GPR1)
MBS7016050-03 5x 0.1 mg

Recombinant Macaca fascicularis G-protein coupled receptor 1 (GPR1)

Sign In for Pricing
View Details
Human Monoclonal B7-H3/CD276 Antibody (mirzotamAb) [Alexa Fluor 594]
NBP3-27981AF594 0.1 mL

Human Monoclonal B7-H3/CD276 Antibody (mirzotamAb) [Alexa Fluor 594]

Sign In for Pricing
View Details