Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP SCF, Human (HEK293, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. GMP SCF Protein, Human (HEK293, His) is the recombinant human-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP SCF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-scf-protein-human-hek-293-his.html

Purity

95.0

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-H214) (Accession)

Molecular Weight

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloro-5-butoxyphenylboronic acid, pinacol ester
425039-01 100 mg

3-Chloro-5-butoxyphenylboronic acid, pinacol ester

Sign In for Pricing
View Details
3-Chloro-5-butoxyphenylboronic acid, pinacol ester
425039-02 250 mg

3-Chloro-5-butoxyphenylboronic acid, pinacol ester

Sign In for Pricing
View Details
USP43 Protein Lysate (Human) with C-Ha Tag
49327031 100 µg

USP43 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rabbit anti-RMP Antibody, Affinity Purified
A301-163A-T 2 µg

Rabbit anti-RMP Antibody, Affinity Purified

Sign In for Pricing
View Details
Mouse Trafd1 activation kit by CRISPRa
GA214285 1 Kit

Mouse Trafd1 activation kit by CRISPRa

Sign In for Pricing
View Details
RPS26P50 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV784551 1.0 µg DNA

RPS26P50 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details