Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP SCF, Human (HEK293, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. GMP SCF Protein, Human (HEK293, His) is the recombinant human-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP SCF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-scf-protein-human-hek-293-his.html

Purity

95.0

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-H214) (Accession)

Molecular Weight

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aquaporin 1 Recombinant Rabbit mAb
E43S47018 100 µL

Aquaporin 1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
FGL1 Antibody, HRP conjugated
MBS7105606-01 0.05 mg

FGL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
FGL1 Antibody, HRP conjugated
MBS7105606-02 0.1 mg

FGL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
FGL1 Antibody, HRP conjugated
MBS7105606-03 5x 0.1 mg

FGL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Boc-NH-PEG12-CH2COOH
MD068121-12 Inquire

Boc-NH-PEG12-CH2COOH

Sign In for Pricing
View Details
Human PIP4K2A Recombinant Protein (N-His)
HD637012-01 50 µg

Human PIP4K2A Recombinant Protein (N-His)

Sign In for Pricing
View Details