Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMP SCF, Human (HEK293, His)

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and regulate a variety of cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members, and PLCG1, producing diacylglycerol and inositol 1,4,5-trisphosphate. GMP SCF Protein, Human (HEK293, His) is the recombinant human-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

GMP SCF Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gmp-scf-protein-human-hek-293-his.html

Purity

95.0

Smiles

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Molecular Formula

4254 (Gene_ID) P21583-1 (E26-H214) (Accession)

Molecular Weight

Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Connexin 43 (phosphorylated Ser265)
311752 100 µL

Connexin 43 (phosphorylated Ser265)

Sign In for Pricing
View Details
Dkk2 (NM_001106472) Rat Tagged Lenti ORF Clone
RR202964L4 10 µg

Dkk2 (NM_001106472) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ACR, CT (ACR, ACRS, Acrosin, Acrosin light chain, Acrosin heavy chain) (FITC)
MBS6271049-01 0.2 mL

ACR, CT (ACR, ACRS, Acrosin, Acrosin light chain, Acrosin heavy chain) (FITC)

Sign In for Pricing
View Details
ACR, CT (ACR, ACRS, Acrosin, Acrosin light chain, Acrosin heavy chain) (FITC)
MBS6271049-02 5x 0.2 mL

ACR, CT (ACR, ACRS, Acrosin, Acrosin light chain, Acrosin heavy chain) (FITC)

Sign In for Pricing
View Details
PLA2G12B Recombinant Protein (Mouse)
RP162500 100 µg

PLA2G12B Recombinant Protein (Mouse)

Sign In for Pricing
View Details
PPIL1 Antibody
A74296-50UL 50 μL

PPIL1 Antibody

Sign In for Pricing
View Details