Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crimean-Congo hemorrhagic fever virus Envelopment polyprotein (GP), partial (Active)

Product Specifications

Product Name Alternative

Envelopment polyprotein; M polyprotein; Mucin-like variable region; GP38; Glycoprotein NNon-Structural protein M; Glycoprotein C; GP

Abbreviation

Recombinant Crimean-Congo hemorrhagic fever virus GP protein, partial (Active)

Gene Name

GP

UniProt

Q8JSZ3

Expression Region

1078-1439aa

Organism

Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) (CCHFV)

Target Sequence

KPTVSTANIALSWSSVEHRGNKILVSGRSESIMKLEERTGISWDLGVEDASESKLLTVSVMDLSQMYSPVFEYLSGDRQVGEWPKATCTGDCPERCGCTSSTCLHKEWPHSRNWRCNPTWCWGVGTGCTCCGLDVKDLFTDYMFVKWKVEYIKTEAIVCVELTSQERQCSLIEAGTRFNLGPVTITLSEPRNIQQKLPPEIITLHPRIEEGFFDLMHVQKVLSASTVCKLQSCTHGVPGDLQVYHIGNLLKGDKVNGHLIHKIEPHFNTSWMSWDGCDLDYYCNMGDWPSCTYTGVTQHNHASFVNLLNIETDYTKNFHFHSKRVTAHGDTPQLDLKARPTYGAGEITVLVEVADMELHTKK

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Glycoprotein N Plays a role in virion attachment to host receptor. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis Glycoprotein N probably locks the Gn-Gc complex in a prefusion state Glycoprotein C Binds to host cell surface receptor LDLR and mediates fusion between viral and cellular membranes. Attachment to receptor induces virion internalization predominantly through clathrin-dependent endocytosis. Class II fusion protein that promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion. Exposure of the glycoprotein spikes to potassium is necessary for the conformational change leading to fusion.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized CCHFV GP at 2 μg/mL can bind Anti-GP recombinant antibody (CSB-RA810349MA1CSC) . The EC50 is 3.136-3.585 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.2 kDa

References & Citations

Intracellular localization of Crimean-Congo Hemorrhagic Fever (CCHF) virus glycoproteins. Haferkamp S., Fernando L., Schwarz T.F., Feldmann H., Flick R. Virol. J. 2:42-42 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histiocytoma Marker (D11), CF405S conjugate, 0.1mg/mL
BNC040348-100 1x 100 µL

Histiocytoma Marker (D11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TXNDC5 Antibody (Biotin)
KB-13014-01 50 μL

TXNDC5 Antibody (Biotin)

Sign In for Pricing
View Details
TXNDC5 Antibody (Biotin)
KB-13014-02 100 µL

TXNDC5 Antibody (Biotin)

Sign In for Pricing
View Details
TXNDC5 Antibody (Biotin)
KB-13014-03 1 mL

TXNDC5 Antibody (Biotin)

Sign In for Pricing
View Details
CD1b (RIV12), CF594 conjugate, 0.1mg/mL
BNC940317-100 1x 100 µL

CD1b (RIV12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Perfluorohexanes (Mixture of Isomers)
TRC-P999223-500MG 500 mg

Perfluorohexanes (Mixture of Isomers)

Sign In for Pricing
View Details