Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-1 protein (GJA1), partial

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein)

Abbreviation

Recombinant Human GJA1 protein, partial

Gene Name

GJA1

UniProt

P17302

Expression Region

233-382aa

Organism

Homo sapiens (Human)

Target Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCP11 (NM_001093728) Human Tagged ORF Clone Lentiviral Particle
RC221388L4V 200 µL

TCP11 (NM_001093728) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FHL3 Protein Vector (Rat) (pPB-C-His)
PV268538 500 ng

FHL3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
KIN Antibody
ASA-B1123 1 Each

KIN Antibody

Sign In for Pricing
View Details
Med28 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6229603 1.0 µg DNA

Med28 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium obg Protein (aa 1-492)
VAng-Yyj2687-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Avium obg Protein (aa 1-492)

Sign In for Pricing
View Details
BIIL-260 hydrochloride 25mg
A21788-25 25 mg

BIIL-260 hydrochloride 25mg

Sign In for Pricing
View Details