Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-1 protein (GJA1), partial

Product Specifications

Product Name Alternative

Connexin-43 (Cx43) (Gap junction 43 kDa heart protein)

Abbreviation

Recombinant Human GJA1 protein, partial

Gene Name

GJA1

UniProt

P17302

Expression Region

233-382aa

Organism

Homo sapiens (Human)

Target Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Superoxide Dismutase 3, Extracellular (SOD3) Antibody Pair Kit (with Standard)
MBS2098459-01 5x 96 Tests

Rabbit Superoxide Dismutase 3, Extracellular (SOD3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rabbit Superoxide Dismutase 3, Extracellular (SOD3) Antibody Pair Kit (with Standard)
MBS2098459-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rabbit Superoxide Dismutase 3, Extracellular (SOD3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rabbit Superoxide Dismutase 3, Extracellular (SOD3) Antibody Pair Kit (with Standard)
MBS2098459-03 10x 96 Tests

Rabbit Superoxide Dismutase 3, Extracellular (SOD3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rabbit Superoxide Dismutase 3, Extracellular (SOD3) Antibody Pair Kit (with Standard)
MBS2098459-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rabbit Superoxide Dismutase 3, Extracellular (SOD3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Kylt® Infectious Bronchitis Virus Standard
31422 10 Reactions

Kylt® Infectious Bronchitis Virus Standard

Sign In for Pricing
View Details
RAB27B Peptide
DF12060-BP 1 mg

RAB27B Peptide

Sign In for Pricing
View Details