Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP-D, Human (HEK293, His)

The SP-D protein plays a critical role in the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifunctional protein interacts with a variety of compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, to modulate leukocyte activity in immune responses. SP-D Protein, Human (HEK293, His) is the recombinant human-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SP-D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sp-d-protein-human-hek-293-his.html

Purity

98.0

Smiles

AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

Molecular Formula

6441 (Gene_ID) AAH22318.1 (A21-F375) (Accession)

Molecular Weight

Approximately 41.33-45.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit
MBS456162-01 48 Tests

Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit

Ask
View Details
Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit
MBS456162-02 96 Tests

Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit

Ask
View Details
Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit
MBS456162-03 5x 96 Tests

Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit

Ask
View Details
Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit
MBS456162-04 10x 96 Tests

Human TGF Beta Inducible Early Response Gene 1 (TIEG1) ELISA Kit

Ask
View Details
ENTPD1 Antibody
A20638-100UG 100 µg

ENTPD1 Antibody

Ask
View Details
Glass cuvette caps for HI937xx (4 pcs)
HI731325N 1 Each

Glass cuvette caps for HI937xx (4 pcs)

Ask
View Details