Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP-D, Human (HEK293, His)

The SP-D protein plays a critical role in the lung's defense mechanisms against inhaled microorganisms, organic antigens, and toxins. This multifunctional protein interacts with a variety of compounds, including bacterial lipopolysaccharides, oligosaccharides, and fatty acids, to modulate leukocyte activity in immune responses. SP-D Protein, Human (HEK293, His) is the recombinant human-derived SP-D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SP-D Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sp-d-protein-human-hek-293-his.html

Purity

98.0

Smiles

AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

Molecular Formula

6441 (Gene_ID) AAH22318.1 (A21-F375) (Accession)

Molecular Weight

Approximately 41.33-45.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti- Beta Lactoglobulin Bovine Antibody
GWB-77CA4C 1 mg

Anti- Beta Lactoglobulin Bovine Antibody

Ask
View Details
Ald-Ph-amido-PEG11-C2-NH2
HY-133546 1 Each

Ald-Ph-amido-PEG11-C2-NH2

Ask
View Details
G-Protein-Coupled Receptor 175 (GPR175, FLJ32197, Integral Membrane Protein GPR175, PP6566, TMEM227, Transmembrane Protein Adipocyte-associated 1, TPRA1, TPRA40) (Biotin)
MBS6141997-01 0.1 mL

G-Protein-Coupled Receptor 175 (GPR175, FLJ32197, Integral Membrane Protein GPR175, PP6566, TMEM227, Transmembrane Protein Adipocyte-associated 1, TPRA1, TPRA40) (Biotin)

Ask
View Details
G-Protein-Coupled Receptor 175 (GPR175, FLJ32197, Integral Membrane Protein GPR175, PP6566, TMEM227, Transmembrane Protein Adipocyte-associated 1, TPRA1, TPRA40) (Biotin)
MBS6141997-02 5x 0.1 mL

G-Protein-Coupled Receptor 175 (GPR175, FLJ32197, Integral Membrane Protein GPR175, PP6566, TMEM227, Transmembrane Protein Adipocyte-associated 1, TPRA1, TPRA40) (Biotin)

Ask
View Details
USP10, ID (USP10, KIAA0190, Ubiquitin carboxyl-terminal hydrolase 10, Deubiquitinating enzyme 10, Ubiquitin thioesterase 10, Ubiquitin-specific-processing protease 10) (MaxLight 750)
MBS6361826-01 0.1 mL

USP10, ID (USP10, KIAA0190, Ubiquitin carboxyl-terminal hydrolase 10, Deubiquitinating enzyme 10, Ubiquitin thioesterase 10, Ubiquitin-specific-processing protease 10) (MaxLight 750)

Ask
View Details
USP10, ID (USP10, KIAA0190, Ubiquitin carboxyl-terminal hydrolase 10, Deubiquitinating enzyme 10, Ubiquitin thioesterase 10, Ubiquitin-specific-processing protease 10) (MaxLight 750)
MBS6361826-02 5x 0.1 mL

USP10, ID (USP10, KIAA0190, Ubiquitin carboxyl-terminal hydrolase 10, Deubiquitinating enzyme 10, Ubiquitin thioesterase 10, Ubiquitin-specific-processing protease 10) (MaxLight 750)

Ask
View Details