Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARC/CCL17, Human

TARC/CCL17 Protein, Human is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human is a recombinant human TARC/CCL17 (A24-S94) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

TARC/CCL17 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tarc-ccl17-protein-human.html

Purity

97.00

Smiles

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Molecular Formula

6361 (Gene_ID) Q92583 (A24-S94) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Julien Catherine, et al. What does elevated TARC/CCL17 expression tell us about eosinophilic disorders? Semin Immunopathol. 2021 Jun;43 (3) :439-458.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Yoshiki Mizukami, et al. CCL17 and CCL22 chemokines within tumor microenvironment are related to accumulation of Foxp3+ regulatory T cells in gastric cancer. Int J Cancer. 2008 May 15;122 (10) :2286-93.|[4]Amr A Al-haidari, et al. CCR4 mediates CCL17 (TARC) -induced migration of human colon cancer cells via RhoA/Rho-kinase signaling. Int J Colorectal Dis. 2013 Nov;28 (11) :1479-87.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (CD45RB) Rat Monoclonal Antibody [Clone ID: 16A]
CL029B 100 µg

CD45 / LCA (CD45RB) Rat Monoclonal Antibody [Clone ID: 16A]

Sign In for Pricing
View Details
PGC1 beta (PPARGC1B) Human Gene Knockout Kit (CRISPR)
KN424480 1 Kit

PGC1 beta (PPARGC1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF647 conjugate, 0.1mg/mL
BNC470948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRB10 Rabbit Polyclonal Antibody
AP20303PU-N 100 µg

GRB10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UFD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G6]
TA804317BM 100 µL

UFD1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G6]

Sign In for Pricing
View Details
EMA (MUC1) Rabbit Monoclonal Antibody [Clone ID: HMFG2]
TA386063 200 µg

EMA (MUC1) Rabbit Monoclonal Antibody [Clone ID: HMFG2]

Sign In for Pricing
View Details