Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARC/CCL17, Human

TARC/CCL17 Protein, Human is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human is a recombinant human TARC/CCL17 (A24-S94) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

TARC/CCL17 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tarc-ccl17-protein-human.html

Purity

97.00

Smiles

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Molecular Formula

6361 (Gene_ID) Q92583 (A24-S94) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Julien Catherine, et al. What does elevated TARC/CCL17 expression tell us about eosinophilic disorders? Semin Immunopathol. 2021 Jun;43 (3) :439-458.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Yoshiki Mizukami, et al. CCL17 and CCL22 chemokines within tumor microenvironment are related to accumulation of Foxp3+ regulatory T cells in gastric cancer. Int J Cancer. 2008 May 15;122 (10) :2286-93.|[4]Amr A Al-haidari, et al. CCR4 mediates CCL17 (TARC) -induced migration of human colon cancer cells via RhoA/Rho-kinase signaling. Int J Colorectal Dis. 2013 Nov;28 (11) :1479-87.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGF alpha Antibody / PDGFA / Platelet Derived Growth Factor A
RQ6784 100 µg

PDGF alpha Antibody / PDGFA / Platelet Derived Growth Factor A

Sign In for Pricing
View Details
Recombinant Human Delta-like protein 3 (DLL3), partial (Active)
CSB-MP882142HU-01 20 µg

Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Delta-like protein 3 (DLL3), partial (Active)
CSB-MP882142HU-02 100 µg

Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Delta-like protein 3 (DLL3), partial (Active)
CSB-MP882142HU-03 1 mg

Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

Sign In for Pricing
View Details
BNP (Brain Natriuretic Peptide) BioAssayTM ELISA Kit (Human) discontinued
382119 96 Tests

BNP (Brain Natriuretic Peptide) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
CNL1GR 6 Die-cut & Printed Numbers & Letters
912184 250 Pack (10 Label (s) x 25 Card)

CNL1GR 6 Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details