Eotaxin/CCL11, Mouse

Eotaxin/CCL11 Protein, Mouse is a potent chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia.

Product Specifications

Product Name Alternative

Eotaxin/CCL11 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eotaxin-ccl11-protein-mouse.html

Purity

98.0

Smiles

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Molecular Formula

20292 (Gene_ID) P48298 (H24-P97) (Accession)

Molecular Weight

Approximately 8-11 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Garcia-Zepeda EA, et al. Human eotaxin is a specific chemoattractant for eosinophil cells and provides a new mechanism to explain tissue eosinophilia. Nat Med. 1996 Apr;2 (4) :449-56.|[2]Salcedo R, et al. Eotaxin (CCL11) induces in vivo angiogenic responses by human CCR3+ endothelial cells. J Immunol. 2001 Jun 15;166 (12) :7571-8.|[3]Antonio L. Teixeira, et al. Revisiting the Role of Eotaxin-1/CCL11 in Psychiatric Disorders. Front Psychiatry. 2018 Jun 14;9:241.|[4]R Salcedo, et al. Eotaxin (CCL11) induces in vivo angiogenic responses by human CCR3+ endothelial cells. J Immunol. 2001 Jun 15;166 (12) :7571-8.|[5]Ljubov Simson, et al. Regulation of carcinogenesis by IL-5 and CCL11: a potential role for eosinophils in tumor immune surveillance. J Immunol. 2007 Apr 1;178 (7) :4222-9.