Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Mouse (HEK293, His)

MMP-2 protein is a ubiquitous metalloprotease that contributes to vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to extracellular matrix degradation, it also targets non-matrix proteins and promotes vasoconstriction. MMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-mouse-hek293-his.html

Purity

95.80

Smiles

MGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

17390 (Gene_ID) NP_032636.1 (M409-C662) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBB1 Polyclonal Antibody, HRP Conjugated
A67371-050 50 µL

TUBB1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Sheep Inhibitor of KB Kinase Beta ELISA Kit
MBS741441-01 48 Well

Sheep Inhibitor of KB Kinase Beta ELISA Kit

Sign In for Pricing
View Details
Sheep Inhibitor of KB Kinase Beta ELISA Kit
MBS741441-02 96 Well

Sheep Inhibitor of KB Kinase Beta ELISA Kit

Sign In for Pricing
View Details
Sheep Inhibitor of KB Kinase Beta ELISA Kit
MBS741441-03 5x 96 Well

Sheep Inhibitor of KB Kinase Beta ELISA Kit

Sign In for Pricing
View Details
Sheep Inhibitor of KB Kinase Beta ELISA Kit
MBS741441-04 10x 96 Well

Sheep Inhibitor of KB Kinase Beta ELISA Kit

Sign In for Pricing
View Details
POLE4 Antibody : HRP (OAAF03576-HRP)
OAAF03576-100UG-HRP 100 µg

POLE4 Antibody : HRP (OAAF03576-HRP)

Sign In for Pricing
View Details