Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-2, Mouse (HEK293, His)

MMP-2 protein is a ubiquitous metalloprotease that contributes to vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to extracellular matrix degradation, it also targets non-matrix proteins and promotes vasoconstriction. MMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

MMP-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-2-protein-mouse-hek293-his.html

Purity

95.80

Smiles

MGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Formula

17390 (Gene_ID) NP_032636.1 (M409-C662) (Accession)

Molecular Weight

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALAS-E (D-4) : m-IgG1 BP-HRP Bundle
sc-532555 1 Kit

ALAS-E (D-4) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
2410018L13Rik (BC063063) Mouse Tagged Lenti ORF Clone
MR200444L3 10 µg

2410018L13Rik (BC063063) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NXPH1 Antibody
MBS7052209-01 0.05 mg

NXPH1 Antibody

Sign In for Pricing
View Details
NXPH1 Antibody
MBS7052209-02 0.1 mg

NXPH1 Antibody

Sign In for Pricing
View Details
NXPH1 Antibody
MBS7052209-03 5x 0.1 mg

NXPH1 Antibody

Sign In for Pricing
View Details
TMPRSS11D antibody
70R-1893 100 ug

TMPRSS11D antibody

Sign In for Pricing
View Details